DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:261 Identity:68/261 - (26%)
Similarity:106/261 - (40%) Gaps:59/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NEYPWMAMLIYENRRLSTM----TNN----CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRL 322
            |.||     .||.:...|:    :.|    |.||:|...:|||||||......|..         
  Fly    39 NGYP-----AYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTI--------- 89

  Fly   323 GEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTP-VRYTHEILPIC 386
             .:..|...:..||..       :|...|..:..:.|.:  .:||||:|  || |.:.|.:..:.
  Fly    90 -YYGATWRTNAQFTHT-------VGSGDFIQNHNWPNQN--GNDIALIR--TPHVDFWHMVNKVE 142

  Fly   387 VP--KDPIPLHNHPLQIA-GWGYT---KNREYSQV----LLHNTVYENRYYCQDKISFFRNESQI 441
            :|  .|...::::...:| |||.|   ...::.:.    ::.|:.....|..|.       :..:
  Fly   143 LPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQP-------DGIL 200

  Fly   442 CASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSEN-CGDRKPGVYTKTGAFFSWIKA 505
            |.|...|:.:|.|||||||:|      .|...|.|:.|:.|.| |....|..:|:......||:.
  Fly   201 CVSTSGGKSTCSGDSGGPLVL------HDGGRLVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRD 259

  Fly   506 N 506
            |
  Fly   260 N 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/259 (26%)
Tryp_SPc 260..503 CDD:214473 65/256 (25%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 65/256 (25%)
Tryp_SPc 37..260 CDD:238113 67/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.