DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Hayan

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:305 Identity:90/305 - (29%)
Similarity:137/305 - (44%) Gaps:57/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PEPGNV-LP-------TSC-----GQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCS 289
            |.|..| ||       .:|     |..|....:..|.......||.||.:.|.:  ..:....|.
  Fly   353 PNPSRVNLPEKERPSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNS--FGSAAFRCG 415

  Fly   290 GSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVH 354
            ||||..|:||||||||..|     |.....||||..:| .||:        ..:.:|.:....:|
  Fly   416 GSLIASRFVLTAAHCVNSD-----DSTPSFVRLGALNI-ENPE--------PGYQDINVIDVQIH 466

  Fly   355 EQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKD-PIPLHNHPLQIAGWGY--TKNREYSQVL 416
            ..|..:|:: .|||:::|....:.:..|.|.|:..| ..|..|:...:||||.  ..||..|::|
  Fly   467 PDYSGSSKY-YDIAILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKIL 530

  Fly   417 LH-----------NTVY-----ENRYYCQDKISFFRNESQICASG-IRGEDSCEGDSGGPLMLTL 464
            |.           |..:     .||...:..|:     ||:||:. .:.:|:|:|||||||:|.:
  Fly   531 LRAALDLVPADECNASFAEQPSANRTLRRGVIA-----SQLCAADKNQRKDACQGDSGGPLILEI 590

  Fly   465 NNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANLKP 509
             :|......:.|::|.|. .|..:.||:||:..:|..:|:..:.|
  Fly   591 -DDVDGTYSIVGVISSGF-GCATKTPGLYTRVSSFLDYIEGIVWP 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 81/265 (31%)
Tryp_SPc 260..503 CDD:214473 80/262 (31%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 80/266 (30%)
Tryp_SPc 385..630 CDD:238113 81/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.