DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG31220

DIOPT Version :10

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:254 Identity:48/254 - (18%)
Similarity:89/254 - (35%) Gaps:80/254 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VMIPIPQYPLYSATIAEFDME-----------QIGYYLDEANKWGLDIAELERSLKEARKTSAPR 292
            ::|..|:.|....::.|.:::           .|.|.::..|....:|.:|.||.||..      
  Fly     1 MVIKAPEDPFEYFSLVEEELDTQPAIERQTPPSIDYLIEITNFSKREIQQLYRSFKELW------ 59

  Fly   293 ILVVINPGNPTGQVLSRSNIEDIIKFAQRERLVLFA-------DEVYQDNVYESGSQFHSFKKVM 350
                     |.|.|       |:.:|.     :::|       .:.|.:.|:::..|........
  Fly    60 ---------PIGTV-------DLEQFQ-----LIYASIFPNGDSKGYAELVFKNIDQNRVGTVTF 103

  Fly   351 MEMGEPYSKMELCSFMSCSKGYMGE-------------CGIRGGYAEIVNLCPDVRTMLLKCISA 402
            ::....|||:        :||.:.|             ||.. .|.||.::...:..|:...:..
  Fly   104 LDFITNYSKI--------AKGTLDERLDWIFTLYDTNRCGFL-AYNEIFHVVKSMYQMMDSSLKP 159

  Fly   403 QLCPTTAGQAVLDCV--VNPPRKGEPSYEQFEKEKASVLESLRERAELVARTFNSIEGF 459
            .:..|...|.|....  :|....|:.|       ||..|:..|..::::|    |:|.|
  Fly   160 AVLATICRQHVKIVFKNLNIANNGKVS-------KAEFLQRCRSDSDILA----SMELF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 44/222 (20%)
CG31220NP_732440.2 Tryp_SPc 104..360 CDD:238113 26/124 (21%)

Return to query results.
Submit another query.