DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG31220

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:371 Identity:148/371 - (39%)
Similarity:195/371 - (52%) Gaps:33/371 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 RKKAQ-NILMSRQCGINTYCCPKQEFPDCPADEKCIRLDKCLRIHNTTMED------GANLMDNR 218
            ||:.: |:....:.|     |...::..|..||:||||..|..|:.....:      ..|:...|
  Fly     4 RKRTEGNLCRRHKSG-----CSANQYKLCEPDEECIRLKDCRPIYYNVRRNRLSGSAKVNISQTR 63

  Fly   219 QCAIDTRRIDSDKRHYICCPEPGNVLPT--SCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRL 281
            .|.:..|.....||.|||||:|.|.||:  .||:.....|:..||....|||||:|||:|.||..
  Fly    64 MCGVSVRDRKRYKRIYICCPKPANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSA 128

  Fly   282 ----STMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGN---C 339
                ..:..:|.|||||.||||||||||     .:|.|.::|||||||..:.||||...|.   |
  Fly   129 FNPDRELVPSCGGSLINTRYVLTAAHCV-----TDTVLQIQRVRLGEHTTSHNPDCISRGARIVC 188

  Fly   340 AAPFVEIGIEYFNVHEQYFNTS-RFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQIAG 403
            |...::|.:|....|..|...: .|.:|||||||:.|||||....||||...|..|....:.:||
  Fly   189 APTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYVAG 253

  Fly   404 WGYTKNREY-SQVLLHNTVYENR-YYCQDKIS--FFRNESQICASGIRGEDSCEGDSGGPLMLTL 464
            ||.|...:. |:||.|..|...: ..|.:|.:  .|....||||.|:....:|:||||.|||.|.
  Fly   254 WGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTS 318

  Fly   465 NNDYQDIVYLAGIVSYGSENCGD-RKPGVYTKTGAFFSWIKANLKP 509
            ...|:.|.:||||.|||.. ||. ..|.|:|:|..|:.||:|:|:|
  Fly   319 GRSYETITFLAGITSYGGP-CGTIGWPSVFTRTAKFYKWIRAHLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 113/258 (44%)
Tryp_SPc 260..503 CDD:214473 111/255 (44%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 112/259 (43%)
Tryp_SPc 104..360 CDD:238113 113/261 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463187
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.