DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG8952

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:295 Identity:77/295 - (26%)
Similarity:127/295 - (43%) Gaps:81/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 EPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAH 303
            :|.|..|.....     |:..|:.|:..::||..:|    :|.:.....|.||:|:..:||||||
  Fly    25 DPANSSPIKIDN-----RIVSGSDAKLGQFPWQVIL----KRDAWDDLLCGGSIISDTWVLTAAH 80

  Fly   304 CVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIG-IEYFN------------VHE 355
            |                               |...::.|:..| ::.||            :|.
  Fly    81 C-------------------------------TNGLSSIFLMFGTVDLFNANALNMTSNNIIIHP 114

  Fly   356 QYFNTSRFESDIALVRLQTPVRYTHEILPICVP---KDPIPLHNHPLQIAGWGYTKNR--EYSQV 415
            .|  ..:..:|::|::|..|:.::..|..|.:.   .|.|........|||:|||::.  :||:.
  Fly   115 DY--NDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSET 177

  Fly   416 LLHNTV--YENRYYCQDKISFFRN----ESQICASGIRGED--SCEGDSGGPLML---TLNNDYQ 469
            ||:..|  .:|    .|.::.:..    :|.:||.|..|.|  :|.|||||||:|   |: ..:|
  Fly   178 LLYAQVEIIDN----ADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTI-QQWQ 237

  Fly   470 DIVYLAGIVSYGSEN-CGDRKPGVYTKTGAFFSWI 503
            .|    ||.|:.:|: |..|.|..|.:..:|..:|
  Fly   238 QI----GINSFVAEDQCTYRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 73/274 (27%)
Tryp_SPc 260..503 CDD:214473 72/272 (26%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 73/276 (26%)
Tryp_SPc 38..271 CDD:238113 73/277 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.