DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG31269

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:106/287 - (36%) Gaps:105/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320
            |:..|.||.....|:...|    :.:|. .::|.|::||:.:||||||||               
  Fly    37 RIIGGQAAEDGFAPYQISL----QGISG-AHSCGGAIINETFVLTAAHCV--------------- 81

  Fly   321 RLGEHDITTNPDCDFTGNCAAPFVEI----------GIEYF----NVHEQYFNTSRFESDIALVR 371
                            .|...|::.:          |..||    ::|..|.| ....:||||:.
  Fly    82 ----------------ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDN-PEMHNDIALLE 129

  Fly   372 LQTPVRYTHEILPICVPKDPIPLHNHPLQ------IAGWG------------------YTKNREY 412
            |..|:.:.....||     |:||  .|:|      :.|||                  |..:||.
  Fly   130 LVEPIAWDERTQPI-----PLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC 187

  Fly   413 SQVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGI 477
            ..:|      .|...|        :...||.....||.:|.|||||||   ::|.     ||.|:
  Fly   188 KALL------SNDEDC--------DVGHICTFSRLGEGACHGDSGGPL---VSNG-----YLVGL 230

  Fly   478 VSYGSENCGDRKPGVYTKTGAFFSWIK 504
            |::|.. |....|.|:.....:..||:
  Fly   231 VNWGWP-CATGVPDVHASVYFYRDWIR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 71/283 (25%)
Tryp_SPc 260..503 CDD:214473 69/280 (25%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/284 (25%)
Tryp_SPc 38..258 CDD:238113 71/286 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.