DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and spirit

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:372 Identity:102/372 - (27%)
Similarity:160/372 - (43%) Gaps:91/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PKQEFPDCPADE------KCIRLDKCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDKR------- 232
            |.:.|.:|..::      .|.|::.|....|..:|                |.:|.|.       
  Fly    44 PVETFDECQLEDVARTKGTCRRMEDCPSALNGWLE----------------RRESPKTCYFVRFD 92

  Fly   233 HYICC-PEPGNVLPTSCGQA-PPLYRMAY-------------GTAARPNEYPWMAMLIYENRRLS 282
            ||:|| |....::..|..|| ..|.:::.             |...||.|:|:||.|.:.:....
  Fly    93 HYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQ 157

  Fly   283 TMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDL---VLRRVRLGEHDITTNPDCDFTGNCAAPFV 344
            .:...|.|:||...:|||||||        .||   ...:||||..::|.....|          
  Fly   158 RIYYRCGGALIANNFVLTAAHC--------ADLGGEPPSQVRLGGDNLTLTEGED---------- 204

  Fly   345 EIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICV--PKDPIPLHNHPLQIAGWGYT 407
             |.|....:|..| :.|...:||||:.|:|..:  .|:.|.|:  .|:   :.|..:...|:|.|
  Fly   205 -ISIRRVIIHPDY-SASTAYNDIALLELETAAK--PELKPTCIWTQKE---VTNTLVTAIGYGQT 262

  Fly   408 -----KNREYSQVLLHNTVYE--NRYYCQDKISFFRNESQICASGIRGE-DSCEGDSGGPLMLTL 464
                 .:.:..:|.|.:...|  ..:|.:|:::.....:|:||..|.|| |:|:|||||||::  
  Fly   263 SFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLM-- 325

  Fly   465 NNDYQD--IVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANLKP 509
                ||  :.|:.||.|.| :.|....|.|||:..:|..||:..:.|
  Fly   326 ----QDGLLGYVVGITSLG-QGCASGPPSVYTRVSSFVDWIEGIVWP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 81/260 (31%)
Tryp_SPc 260..503 CDD:214473 79/257 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 12/62 (19%)
Tryp_SPc 132..364 CDD:238113 81/263 (31%)
Tryp_SPc 132..361 CDD:214473 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.