DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG32260

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:291 Identity:98/291 - (33%)
Similarity:145/291 - (49%) Gaps:44/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PEPGNVLP---TSCG-QAPPLYRMAYGTAARPNEYPWMAMLIY--ENRRLSTMTNNCSGSLINKR 296
            |.|.|..|   .:|| ......|:..|..||...|||:|.|.|  ||.| :.:...|.||||:.|
  Fly   305 PPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNR-NALKFLCGGSLIHSR 368

  Fly   297 YVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTS 361
            ||:|:|||      :|..|.|  ||||.||::...:        :..:::.|....||| :|:.:
  Fly   369 YVITSAHC------INPMLTL--VRLGAHDLSQPAE--------SGAMDLRIRRTVVHE-HFDLN 416

  Fly   362 RFESDIALVRLQTPVRYTHEILPICVP-------KDPIPLHNHPLQIAGWGYTKNREY-SQVLLH 418
            ...:||||:.|.........|.|||:|       :|.:.:  :|. :||||..|::.. ||||..
  Fly   417 SISNDIALIELNVVGALPGNISPICLPEAAKFMQQDFVGM--NPF-VAGWGAVKHQGVTSQVLRD 478

  Fly   419 NTV-YENRYYCQDK----ISFFRNESQICASGIRGEDSCEGDSGGPLMLTL--NNDYQDIVYLAG 476
            ..| ..:|:.|:..    ..|.:...::..:|....|:|:||||||||:..  .|.|:  .||.|
  Fly   479 AQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYR--FYLLG 541

  Fly   477 IVSYGSENCGDRKPGVYTKTGAFFSWIKANL 507
            :||:|.|......|||||:..::..|||.::
  Fly   542 LVSFGYECARPNFPGVYTRVASYVPWIKKHI 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 91/262 (35%)
Tryp_SPc 260..503 CDD:214473 88/259 (34%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 89/263 (34%)
Tryp_SPc 328..571 CDD:238113 91/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.