DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG11664

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:107/257 - (41%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVL 317
            |:.:..||          ..|.||..:.|:      :|||.:.|||||.|||..|    ||....
  Fly    28 PVQQQNYG----------YVMQIYGPQFLA------AGSLFSARYVLTVAHCFKK----NTKPEE 72

  Fly   318 RRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEI 382
            ..||.|...|.    .:|.|...|..:.        |.: |:.....:|||::|::..:.::|.|
  Fly    73 LSVRAGYRWIA----WEFRGKQVAGLLR--------HPK-FSPLTLRNDIAVLRVKAAISHSHMI 124

  Fly   383 --LPICV-PKDPIPLHNHPLQIAGWGYTKNREYSQVLLH--------NTVYENRYYCQD---KIS 433
              :.:|. |..|:.:...|.::|||.          |:|        :...|....|:.   :||
  Fly   125 NYIGLCSRPLTPLNMFAPPQELAGWN----------LMHIAQPLKSMSVQVEPEKNCRQWFPQIS 179

  Fly   434 FFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRK-PGVYT 494
                ...||||...||..|.||||.||:     ...::..||  :::  ..|||:: |.::|
  Fly   180 ----GGVICASATMGEGLCYGDSGDPLI-----SGGEVCGLA--IAF--RKCGDKRYPALFT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 67/250 (27%)
Tryp_SPc 260..503 CDD:214473 67/250 (27%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 66/237 (28%)
Tryp_SPc 38..237 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.