DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG18636

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:276 Identity:87/276 - (31%)
Similarity:116/276 - (42%) Gaps:60/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LPTSCG---QAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCV 305
            |..:||   |:...||:..|..|:.|..|||..|     ..:|....|.||||..:.|||||||.
  Fly    29 LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL-----HSTTDMFVCGGSLITDKLVLTAAHCF 88

  Fly   306 VKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFE------ 364
            :    .|..||   .||||::.|.:.:|  ||           .|.|..|::...:.|:      
  Fly    89 I----ANQHLV---ARLGEYERTRSEEC--TG-----------YYCNFREEHMVDAGFKHKLYDP 133

  Fly   365 ----SDIALVRLQTPVRYTHEILPICVP--------KDPIPLHNHPLQIAGWGYTKNREYSQVLL 417
                :|||::||...|.|...|.||||.        .|.|.|    |...|||.|:....|..| 
  Fly   134 NTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDL----LTATGWGKTQMESDSDAL- 193

  Fly   418 HNTVYENRYYCQDKISFFRNE----SQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIV 478
              ...:.|....|..:.|..:    :|.|| |....:.|.|||||||...:.:.........||.
  Fly   194 --QTLDIRRQPPDVCAKFIGQTIAGNQFCA-GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIA 255

  Fly   479 SYGSENCGDRKPGVYT 494
            ||.:.||  :|..|:|
  Fly   256 SYTNRNC--QKASVFT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 81/257 (32%)
Tryp_SPc 260..503 CDD:214473 81/257 (32%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 82/261 (31%)
Tryp_SPc 45..278 CDD:238113 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463532
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.