DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG33461

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:286 Identity:92/286 - (32%)
Similarity:131/286 - (45%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LPTSCGQAPPL-YRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVK 307
            |..:||..|.| |::..||.||...|||||.|......|      |:|||||:.:|||:|||:..
  Fly    28 LEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFL------CAGSLINQWFVLTSAHCIED 86

  Fly   308 DKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRL 372
            |    .:|:   .||||::...:.||: ...|.....|..::....|..| :...|.:||.::||
  Fly    87 D----VELI---ARLGENNRDNDIDCE-NNRCLEATQEYNVDMLFKHRLY-DPKDFSNDIGMLRL 142

  Fly   373 QTPVRYTHEILPICVPKDPIPLHNHPLQI----------AGWGYTK---NREYSQVLLHNTVYEN 424
            :..|.||:.|.|||:      .|:..:|:          .|||.|.   |.:.|:||:...:|..
  Fly   143 ERRVEYTYHIQPICI------FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRR 201

  Fly   425 ------RYYCQDKISFFRNESQICASGIRGEDSCEGDSGGP-----LMLTLNNDYQDIVYLAGIV 478
                  |.:.|:.:|     .||||....| :.|.||||||     |:..:....|     .||.
  Fly   202 PRNDCARIFKQNFLS-----GQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQ-----MGIA 255

  Fly   479 SYGSENCGDRKPGVYTKTGAFFSWIK 504
            |:..|||.  |..:.|....:..|||
  Fly   256 SFTYENCS--KVSILTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 86/269 (32%)
Tryp_SPc 260..503 CDD:214473 83/266 (31%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 83/270 (31%)
Tryp_SPc 42..281 CDD:238113 86/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463499
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.