DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and Sp212

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:313 Identity:84/313 - (26%)
Similarity:124/313 - (39%) Gaps:89/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PEPGNVLPTS------CGQ----APPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSL 292
            |.|....|.|      ||:    .|.:.|   |......:|||::.:.::..|  .:...|.|||
  Fly   251 PPPQRFDPRSQISSVVCGREGSTTPFIVR---GNEFPRGQYPWLSAVYHKEVR--ALAFKCRGSL 310

  Fly   293 INKRYVLTAAHCV---VKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNV- 353
            |:...|::|||||   .:|::|        |.||.:|:.             .:.|.|.|..|| 
  Fly   311 ISSSIVISAAHCVHRMTEDRVV--------VGLGRYDLD-------------DYGEDGAEMRNVM 354

  Fly   354 ----HEQYFNTSRFESDIALVRLQTPVRYTHEILPICV----PKDPIPLHNHPLQIAGWGY---T 407
                |..|...|..::||||:.::.||.:...|.|||:    ....:.....   |||||.   :
  Fly   355 RLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGF---IAGWGRDEDS 416

  Fly   408 KNREYSQV----LLHNTVYENRYYCQDKISFFR----NESQICASGIRGEDSCEGDSGGPLMLTL 464
            ...:|.:|    :...||      |   .|.:|    .|..:||....|...|.|||||.||:..
  Fly   417 SRTQYPRVVEAEIASPTV------C---ASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQ 472

  Fly   465 NNDYQDIVYLAGIVSYGSENCGDRKPG---------VYTKTGAFFSWIKANLK 508
            .:.:    .|.||||     .|:|.|.         :|.......:||..|::
  Fly   473 GDRW----LLRGIVS-----AGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 75/277 (27%)
Tryp_SPc 260..503 CDD:214473 73/274 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 76/283 (27%)
Tryp_SPc 277..511 CDD:214473 74/280 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.