DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30323

DIOPT Version :10

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:215 Identity:43/215 - (20%)
Similarity:78/215 - (36%) Gaps:72/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYF- 351
            |:|||::..:|:|:..||                      :|.|:.  |.|..:....:.:..| 
  Fly    54 CAGSLLSAWWVVTSGCCV----------------------STRPES--TPNQPSNRKNLRVVVFT 94

  Fly   352 -------------NVHEQYFNTSRFE--SDIALVRLQTPVRYTHEILPICVPKDPIP---LHNHP 398
                         :|.:...:.|...  :::||::|...|  |.:...:.:|:..:.   |.|. 
  Fly    95 PKRLKKPSPKNIYHVQKIVLDESAISGCTELALLKLDRGV--TGQRFAMMLPEKELNSTWLCNS- 156

  Fly   399 LQIAGWG--YTKNREYSQVL--LHNTVYENRY-YCQD-------------KISFFRNESQ----I 441
               .|||  |..:..|...:  ..:.||:|.. :.||             |||.:..:..    :
  Fly   157 ---LGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCL 218

  Fly   442 CASGIRGE-DSCEGDSGGPL 460
            |.:...|. :.|:.|.|.||
  Fly   219 CMTSYTGRGNMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 43/215 (20%)
CG30323NP_725729.2 COG5640 <50..280 CDD:444365 43/215 (20%)

Return to query results.
Submit another query.