DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30289

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:270 Identity:89/270 - (32%)
Similarity:137/270 - (50%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 VLPTSCG---QAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHC 304
            :|..:||   ..|.:..:..|......|.||| :|::.::       .|.||||.:::|||||||
  Fly    25 LLVENCGISKDDPYVPNIFGGAKTNIQENPWM-VLVWSSK-------PCGGSLIARQFVLTAAHC 81

  Fly   305 VVKDKMVNTDLVLRRVRLGEHD-ITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIA 368
            |..:.:.        ||||::: :...|.| ...:|...|..|.::...|||.| |....::|||
  Fly    82 VSFEDLY--------VRLGDYETLDPMPYC-LNNHCIPKFYNISVDMKIVHENY-NGITLQNDIA 136

  Fly   369 LVRLQTPVRYTHEILPICV----PKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYE-NRYYC 428
            |:|:...|.|:..:.|||:    ....||:    ..:.|||.|:..::|::||:.|:|. :..||
  Fly   137 LLRMSEAVEYSDYVRPICLLVGEQMQSIPM----FTVTGWGETEYGQFSRILLNATLYNMDISYC 197

  Fly   429 QDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVY 493
            ..|.:...:.||||| |....::|:|||||||....:...:.:.:..|:||||||.|.....|||
  Fly   198 NIKFNKQADRSQICA-GSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVY 261

  Fly   494 TKTGAFFSWI 503
            |.......||
  Fly   262 TNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 85/250 (34%)
Tryp_SPc 260..503 CDD:214473 83/248 (33%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 83/251 (33%)
Tryp_SPc 42..271 CDD:238113 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.