DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30286

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:272 Identity:90/272 - (33%)
Similarity:121/272 - (44%) Gaps:29/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKD 308
            |...||...|.........|..:|.||||.| :::..|.     |.|:|:|.|::||||||:.:|
  Fly    22 LEPDCGYMSPEALQNEEHQAHISESPWMAYL-HKSGELV-----CGGTLVNHRFILTAAHCIRED 80

  Fly   309 KMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQ 373
            :.:.       |||||.:..|:.||: ..:|..|..:..|:....|..|..|:|.. ||.|:||.
  Fly    81 ENLT-------VRLGEFNSLTSIDCN-GSDCLPPSEDFEIDVAFRHGGYSRTNRIH-DIGLLRLA 136

  Fly   374 TPVRYTHEILPICV-------PKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYE-NRYYCQD 430
            ..|.|...|.|||:       ||..   ..|.|...|||.:.:...:.:|....|.. |...|..
  Fly   137 KSVEYKVHIKPICLITNTTLQPKIE---RLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSK 198

  Fly   431 KISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTK 495
            .....|...|||.|...|. ||.||||||:...:..|.:.:....||||||:..|  ..|.|:|.
  Fly   199 TYWVDRRRDQICVSHESGV-SCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAEC--LSPSVFTN 260

  Fly   496 TGAFFSWIKANL 507
            ......||.|.|
  Fly   261 VMEHIDWIMAAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 84/253 (33%)
Tryp_SPc 260..503 CDD:214473 82/250 (33%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 83/250 (33%)
Tryp_SPc 39..268 CDD:214473 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463576
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.