DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30187

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:254 Identity:79/254 - (31%)
Similarity:121/254 - (47%) Gaps:52/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 WMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCD 334
            |||.:  .||....    |.|:||:||:|||||||:|       |..::.|.||.:         
  Fly    49 WMAAV--HNRTHFI----CGGTLIHKRFVLTAAHCIV-------DQDVQSVSLGAY--------- 91

  Fly   335 FTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNH-- 397
               |.:.|.....:....||..:...:.:|:||.|::|.:.|.:...|.|||:..:. .:.||  
  Fly    92 ---NKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNK-SMANHMR 152

  Fly   398 ---PLQIAGWGYTKNREYSQVLLHNTVYEN---RYYCQDKISFFRNESQICASGIRGEDSCEGDS 456
               ..:..|||..:..:.|.:|  .|:..|   |..|..::|.:.:|.|||| |:...|:|.|||
  Fly   153 NMRTFKAFGWGTLRGNKTSDIL--QTIILNHLDREECYMELSVYPSEKQICA-GVPSGDTCGGDS 214

  Fly   457 GGPLMLTLNNDY-------QDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANLK 508
            |||    |.||.       :::.:  ||:|.|..:|..:  ||||...:|..|||..::
  Fly   215 GGP----LTNDVFIQGIGNREVQF--GIISVGKTSCDGQ--GVYTDLMSFADWIKMTIE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 79/250 (32%)
Tryp_SPc 260..503 CDD:214473 76/247 (31%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 76/247 (31%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.