DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30098

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:113/276 - (40%) Gaps:76/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320
            |:..|..||  ..||||.||.:||..      |.||||..|:|||||||.    .:|.:|.   |
  Fly    36 RVIGGQNAR--RTPWMAYLIRDNRFA------CGGSLIAYRFVLTAAHCT----KINDNLF---V 85

  Fly   321 RLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFES-DIALVRLQTPVRYTHEILP 384
            ||||:|.:...|    |...:..|   :..:. |:.|.:   |.: |||:::|...|.|...|.|
  Fly    86 RLGEYDSSRTTD----GQTRSYRV---VSIYR-HKNYID---FRNHDIAVLKLDRQVVYDAYIRP 139

  Fly   385 ICVPKDPIPLHNHPLQ----------IAGWGYTKNREYSQVLLHNTVYENRYY----CQDKISFF 435
            ||:      |.|..||          :.|||.         :.|       ||    ...::|..
  Fly   140 ICI------LLNSGLQSLANSIQNFTLTGWGQ---------MAH-------YYKMPTTLQEMSLR 182

  Fly   436 RNESQICASGIRG---------EDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPG 491
            |..::.|  |:..         :.:|.|||||||...:...::.|....|:.:..:.||..... 
  Fly   183 RVRNEYC--GVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS- 244

  Fly   492 VYTKTGAFFSWIKANL 507
             |....::..|:...|
  Fly   245 -YLDLMSYMPWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 76/269 (28%)
Tryp_SPc 260..503 CDD:214473 75/266 (28%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/269 (28%)
Tryp_SPc 37..258 CDD:238113 76/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.