DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG30091

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:294 Identity:84/294 - (28%)
Similarity:124/294 - (42%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RRIDSDKRHYICCPEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNN-- 287
            |.:|.|      |..|..::|...|          |..|...:.||||::         .||:  
  Fly    21 RLLDED------CGVPMQLIPKIVG----------GVDAGELKNPWMALI---------KTNDEF 60

  Fly   288 -CSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYF 351
             |.||:|..::|||||||:..|:..........|.||.:.:..      ||....|.....:|..
  Fly    61 ICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLA------TGEHNHPHEIYNVERV 119

  Fly   352 NVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPLHNHPLQ----------IAGWGY 406
            .:|:. |....:.:||||:|||..:.|..:|.|:|:      |.|..|:          ..|||.
  Fly   120 YIHDS-FAIQNYRNDIALLRLQKSIVYKPQIKPLCI------LLNDQLKPQTDLIQEFTAIGWGV 177

  Fly   407 TKNREYSQVLLHNTVYE-NRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQD 470
            |.|.:.|..|....:|. :|..|:....:..:....||....|.|:|:.||||||.:.:..|...
  Fly   178 TGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIK 242

  Fly   471 IVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504
            .....||||.|:|:|  |..|:||.......:|:
  Fly   243 RATQLGIVSTGTEDC--RGFGMYTDVMGHIDFIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 77/259 (30%)
Tryp_SPc 260..503 CDD:214473 76/256 (30%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 77/270 (29%)
Tryp_SPc 37..276 CDD:238113 78/272 (29%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463565
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.