DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and try-4

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:339 Identity:67/339 - (19%)
Similarity:123/339 - (36%) Gaps:94/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 TMEDGANLMDNRQCAIDTRRIDSDKRHYICCPEPGNVLPTSCGQAPPLYRMAYGTAARPNEYPWM 271
            :||....::||                        .||..|||         ....::...:||.
 Worm    30 SMESFQTIVDN------------------------EVLMESCG---------IQQESKIKNFPWA 61

  Fly   272 AMLIYENRRLSTMTNNCSGSLINKRYVLTAAH------------CVVKD-KMVNTDLV------- 316
            .....:.      .|...||:|:..:::||||            |..|: |..|:.:.       
 Worm    62 VSFTVDG------VNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLR 120

  Fly   317 -LRRVRLGEHDI-------TTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFES-DIALVRL 372
             .|:|..|...|       ..:|.|.     .:..:...:....|..::.:::..:. |.|:|.:
 Worm   121 DTRKVAYGGTCIRGHTDKYPNDPRCK-----KSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEV 180

  Fly   373 QTPVRYTHEILPICVPKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENRYYCQ----DKIS 433
            :..:.::..:.|||:|: |...:...|.:.|||.:.....|..|:|.........|:    |::.
 Worm   181 EKRIHFSENVRPICLPR-PNMYYTKSLAVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDRLP 244

  Fly   434 FFRNESQICASGIRGED-----SCEGDSGGPLMLTLNNDYQDIVY----LAGIVSYGSENCGDRK 489
            ...::. |||:.:...:     :|.|||||.|      :|:|..|    |..|.|:|:..|....
 Worm   245 ADADDF-ICATSMNVSNYSAPRTCHGDSGGGL------EYRDDNYGRAFLIAITSFGTRGCPSNM 302

  Fly   490 PGVYTKTGAFFSWI 503
            ...:|:...:.:.|
 Worm   303 LARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 58/286 (20%)
Tryp_SPc 260..503 CDD:214473 57/284 (20%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 58/285 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.