DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and try-3

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:267 Identity:65/267 - (24%)
Similarity:105/267 - (39%) Gaps:69/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 WMAMLI-YENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDC 333
            |||.|: |.:.....:   |..::|:..:::|||||.:  ::.....|..|......:       
 Worm    50 WMAKLVSYGDNGQGIL---CGATVIDDFWLVTAAHCAL--QLQTRSFVYVREPKNNRE------- 102

  Fly   334 DFTGNCAAPFVEIGIEYFNVHEQY----FNTSRFESDIALVRLQTPVRYTHEILPICVPKDPIPL 394
                           ..|:|.|.|    :|....::||||:|:.:.:... .|.|:|:..|...|
 Worm   103 ---------------RSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKL-GIKPVCLVHDDSKL 151

  Fly   395 HNHPLQ--IAGWGYTKNRE--------YSQVLLHNTV-----------YENRYYCQDKISFFRNE 438
            ......  :.|:|.|...:        .||.|...:|           :........||:.:   
 Worm   152 LKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGY--- 213

  Fly   439 SQICASGIRGEDSCEGDSGGPLML-TLNNDYQDIVYLAGIVSYGSENCG-----DRKPGVYTKTG 497
             |||| |.....:..|||||||:: ..|.:|..|    ||.|||::...     .:.|||||:..
 Worm   214 -QICA-GAYLHGTAPGDSGGPLLIHKSNGEYVQI----GITSYGADGLDGVIDQGKFPGVYTRIS 272

  Fly   498 AFFSWIK 504
            .:..||:
 Worm   273 KYVPWIQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 65/267 (24%)
Tryp_SPc 260..503 CDD:214473 63/264 (24%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 64/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.