DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG43742

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:255 Identity:89/255 - (34%)
Similarity:121/255 - (47%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 YRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRR 319
            ||:|.|..|..:::  ||.| |.|....     |.||||:|:|||||||||       .||....
  Fly    33 YRVANGHTAITSQF--MAAL-YNNSEFF-----CGGSLIHKQYVLTAAHCV-------RDLDEVT 82

  Fly   320 VRLGEHDITTN-PDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEIL 383
            |.|||::.:.. |.|.......|..:        :|.. |:.:.|.:||||:||:..|.:...|.
  Fly    83 VHLGENNRSCPIPVCKHVLRLNAKVI--------LHPN-FHGNIFLNDIALLRLEREVIFEAHIR 138

  Fly   384 PICVPKDPIPLHNHPLQIA--GWGYTKNREYSQVL-LHNTVYENRYYCQDKISFFRNESQICASG 445
            |||:..|.....|:.....  |||.|::...|.|| ..:.|...:..|      ::|.:.|||..
  Fly   139 PICIILDEDVTSNNQNNFTAYGWGKTEHGNISDVLSFIDLVRLPKSMC------YQNINTICAGS 197

  Fly   446 IRGEDSCEGDSGGPLM--LTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWI 503
            ..| |:||.||||||:  .......:||::  ||.|||...|.... ||||...|:.|||
  Fly   198 TSG-DTCESDSGGPLIGNFVHRGKSRDILF--GITSYGDAECSGLF-GVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 86/250 (34%)
Tryp_SPc 260..503 CDD:214473 84/248 (34%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 86/252 (34%)
Tryp_SPc 35..256 CDD:238113 87/253 (34%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463587
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.