DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG43335

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:282 Identity:86/282 - (30%)
Similarity:129/282 - (45%) Gaps:36/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 YICCPEPGNVLPTSCG-QAPPLY---RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLIN 294
            ::|......:|..:|| :..|.:   |:..|:.|....:||||.|..|....      |:|:||.
  Fly    15 WLCRFGESRLLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYF------CAGTLIT 73

  Fly   295 KRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPD--CDFTGNCAAPFVEIGIEYFNVHEQY 357
            .::|||||||:...|.:.       ||||...:|.:..  |..|....:  |.:.|::     :|
  Fly    74 NQFVLTAAHCIEASKNLT-------VRLGGSGLTRSDGSMCQITAEDYS--VSMAIKH-----KY 124

  Fly   358 FNTSRFESDIALVRLQTPVRYTHEILPICVPKDP----IPLHNHPLQIAGWGYTKNREYSQVLLH 418
            |..|...:|||::||...|::...|.|||:..||    :......|...|||....|.:..:|..
  Fly   125 FTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQE 189

  Fly   419 NTV-YENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLA-GIVSYG 481
            ..: ..||..|.........:.|||| |.:..::|.|||||||...:|. |.|:.::. ||.|:|
  Fly   190 APITVMNRNVCSKLYDVAITQGQICA-GDKETNTCLGDSGGPLGGVVNY-YGDLRFVQYGITSFG 252

  Fly   482 SENCGDRKPGVYTKTGAFFSWI 503
            ...|  |.|.:||....:..||
  Fly   253 DIEC--RSPSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 80/252 (32%)
Tryp_SPc 260..503 CDD:214473 78/250 (31%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 79/254 (31%)
Tryp_SPc 42..275 CDD:238113 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463675
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.