DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG43124

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:96/247 - (38%) Gaps:72/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDC 333
            ||:|.::.:::.:      |:|:|||..||||||.|..:::.:.       ||||          
  Fly    41 PWLAEILSDSKVI------CAGALINNLYVLTAASCFKENEKLT-------VRLG---------- 82

  Fly   334 DFTGNCAAPFVEIGIEYFNVHEQYFNTSRF----ESDIALVRLQTPVRYTHEILPICVPKDPIPL 394
                   :.:.:...|.|.|.:.||..:.|    .:::.:.||||.|.:...|.|:|:.|.|..|
  Fly    83 -------SGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSL 140

  Fly   395 HNHPLQIAGWGYTKNREYSQVLLHNTVYENRYYCQD------KISFFRNESQICASGIRGEDSCE 453
                      |.....|     :.|...:..|:|::      |..|..||.: ..|...|....|
  Fly   141 ----------GLATTFE-----IINEKPKMWYFCKNIKGLFCKYVFGENEEK-WQSKPTGSPWTE 189

  Fly   454 GDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRK--PGVYTKTGAFFSWI 503
            ..|.||              ..|:|.||..:..|.|  ..||....:..:||
  Fly   190 TISNGP--------------FKGLVRYGILSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 61/247 (25%)
Tryp_SPc 260..503 CDD:214473 59/245 (24%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.