DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and CG42694

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:273 Identity:69/273 - (25%)
Similarity:116/273 - (42%) Gaps:61/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 CGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTN-NCSGSLINKRYVLTAAHCV-VKDKM 310
            ||  .|:...:. |..|..:..|:|       .:|..|: .||||||:|::||:||.|: |..|:
  Fly    27 CG--APISNQSI-TKLRQPQAGWLA-------HISNGTHVLCSGSLISKQFVLSAAQCIDVHGKL 81

  Fly   311 VNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTP 375
            .        |:||..:.|.:|......|...|              ..:..|.:.||.|::|...
  Fly    82 F--------VQLGVSNATKSPHWYTVSNVVIP--------------SHSGKRLQRDIGLLKLSQS 124

  Fly   376 VRYTHEILPICVPKDPIPLHNHPLQI---------AGWGYTKNREYSQVLLHNTVYENRYYCQDK 431
            |.|...:.|||     |.|:.:.|.:         :.| .:||:....::|...   :|..|:..
  Fly   125 VDYNDFVYPIC-----IALNTNTLDMVKILQNFTTSAW-LSKNKNPQTIVLSQL---SRDRCKLN 180

  Fly   432 ISFFRNESQICASGIRGEDSCEGDSGGPL---MLTLNNDYQDIVYLAGIVSY--GSENCGDRKPG 491
            :|......:|||:.::..:||..|||..|   ::..:|..:::::  ||..|  |...|.:  |.
  Fly   181 LSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLF--GIRGYVNGRSWCSE--PA 241

  Fly   492 VYTKTGAFFSWIK 504
            :|........||:
  Fly   242 IYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 66/261 (25%)
Tryp_SPc 260..503 CDD:214473 64/258 (25%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 64/251 (25%)
Tryp_SPc 46..253 CDD:214473 62/248 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.