DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and proc.2

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:332 Identity:94/332 - (28%)
Similarity:143/332 - (43%) Gaps:53/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DCPADEKCIRLDKCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYICCPEPGNVLPTSCGQA 251
            |.|..|| ..::|....||   |.||::   |.....|.:...::.|.:...||.: ..|..|..
 Frog   378 DDPTAEK-KPINKTSLDHN---EIGASV---RAARTGTSKSVWEENHGLASVEPDD-YNTPDGDV 434

  Fly   252 PPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLV 316
                |:..|......:.||. :||..||....    |.||||:.|:||:||||....       :
 Frog   435 ----RIVGGMRCELGQCPWQ-VLIRNNRGFGF----CGGSLISSRWVLSAAHCFESQ-------I 483

  Fly   317 LRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNV--HEQYFNTSRFESDIALVRLQTPVRYT 379
            ...|.:|::| |...|.|          |..|....|  |..|. ...::.||||:.|::|..:.
 Frog   484 PHHVTIGDYD-TYRRDMD----------EQKIAVLQVFSHPNYL-AEFYDHDIALLFLRSPAMFG 536

  Fly   380 HEILPICVPKDP-----IPLHNHPLQIAGWGYTKN-REYSQVLLH-NTVYENRYYCQDKISFFRN 437
            ....|||:| :|     :.......|::|||.|:. ..|::.||. .....::..|.........
 Frog   537 EYSRPICLP-NPGLGKMLTQEGQTGQVSGWGATRQFGPYTRFLLKVRLPIVSQETCMASTENILT 600

  Fly   438 ESQICASGIRG-EDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDR-KPGVYTKTGAFF 500
            .:..||....| :|:|.||||||..:.    :.|..:|.|:||:| :.|.:: |.||||:...:.
 Frog   601 GNMFCAGYKEGVKDACSGDSGGPFAVL----FHDTWFLVGVVSWG-DGCAEKGKYGVYTRVANYM 660

  Fly   501 SWIKANL 507
            .|||..:
 Frog   661 PWIKETI 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 76/256 (30%)
Tryp_SPc 260..503 CDD:214473 73/253 (29%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 76/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.