DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10232 and LOC100004411

DIOPT Version :9

Sequence 1:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:503 Identity:111/503 - (22%)
Similarity:179/503 - (35%) Gaps:157/503 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HFQPLVRRRVYVNCQR----------QEIFP------CQYDEICRSRDSCPFLKLKRK------- 162
            |....::||..|:..|          :|:.|      | |:|:|...::....:...|       
Zfish    20 HSSVFLQRRDAVSVFRIRTRRANTFLEEMKPGSLEREC-YEELCSLEEASEIFQSTEKTMEFWYR 83

  Fly   163 -KAQNILMSRQC----------GINTYCCP--------KQEFPDCPADEKCIRLDKCLRIHNTTM 208
             |..|:.....|          |:....||        :.|..||.     .:...||  |..:.
Zfish    84 YKNLNLCRFNPCQNGGMCRENRGVQECLCPPLYSGTNCETEVSDCK-----YKNGGCL--HYCSQ 141

  Fly   209 EDGANLMDNRQCA-IDTRRIDSDKRHYICCP---------------------------EPGNVLP 245
            .:.|.:    :|: .|..::|.|:  :.|.|                           :..|...
Zfish   142 NETAGV----ECSCADGYQLDEDR--HSCSPAVQYPCGKQWTGGIMSRSLDDVSHTHADYANHTH 200

  Fly   246 TSCGQAPPLY-------------------------------------RMAYGTAARPNEYPWMAM 273
            :|...:.||:                                     |:..|...|....||..:
Zfish   201 SSTSPSHPLHHNRSALENSTHQNQTELTAPDQLLDTGSDFTGGNEDTRIVGGQLQRQGGSPWQVL 265

  Fly   274 LIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDCDFTGN 338
            |..|:.     ...|.|||||:|:|:|||||:.:..        ..:.:|::| ...||.|..  
Zfish   266 LRREDE-----YGFCGGSLINQRWVITAAHCLQQTP--------HHITIGDYD-KMRPDKDEQ-- 314

  Fly   339 CAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRYTHEILPICVP----KDPIPLHNHPL 399
                  :|.:|....|..|...: |:|||||:.|.:.|.......|.|:|    .:.:.......
Zfish   315 ------KITVEKIIPHPHYHEYT-FDSDIALLYLSSAVTLGPFASPACLPDANLAERLMKPGEQG 372

  Fly   400 QIAGWGYTKNREYSQVLLHNT---VYENRYYCQDKISFFRNESQICASGIRGE-DSCEGDSGGPL 460
            .::|||.|...:.|...|...   |.|.: .|.:.......::..||..:..| |:|.||||||.
Zfish   373 LVSGWGSTHYLQRSSRFLRKVQLPVVEQK-SCINSTEQIITDNMFCAGFLMEEMDACTGDSGGPF 436

  Fly   461 MLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIKANLK 508
            ::    :|:...:|.|:||:|.......|.||||:.|.:.|||:..:|
Zfish   437 IV----NYRGTWFLTGVVSWGERCASQGKYGVYTRLGNYLSWIQEEMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 74/253 (29%)
Tryp_SPc 260..503 CDD:214473 72/250 (29%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503 11/63 (17%)
EGF_CA 86..122 CDD:238011 5/35 (14%)
FXa_inhibition 128..164 CDD:291342 9/48 (19%)
Tryp_SPc 248..475 CDD:214473 73/254 (29%)
Tryp_SPc 249..477 CDD:238113 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.