DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and myog

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001016725.1 Gene:myog / 549479 XenbaseID:XB-GENE-490105 Length:235 Species:Xenopus tropicalis


Alignment Length:284 Identity:96/284 - (33%)
Similarity:133/284 - (46%) Gaps:80/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QQNPIAHPGQNPHQTLQNFFS----RFNAVGDASAGNGG--AASISANGSGSSCNYSHANHNPVE 98
            :.:|...|.|..:.. .|:||    .:...|....|..|  |..:...|||            :|
 Frog     5 ETSPYFFPDQRFYDN-DNYFSARLPTYEQTGFQDRGTVGICADGVLLQGSG------------IE 56

  Fly    99 LDKPLGMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRR 163
             ||     ::|.|           :::.:||      |..     .||.||||.||:|:|::|||
 Frog    57 -DK-----VSPHP-----------TVTQQEH------CPG-----QCLPWACKVCKRKTVSMDRR 93

  Fly   164 KAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLL----QESSTTRD 224
            :|||:||:|||:|||||||.|||.|..|||||||||||||:||:|||.|:.||    |:....||
 Frog    94 RAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQTLLASLNQQERDQRD 158

  Fly   225 ------GDNLAPS----LSGKSCQSDYL-SSYAGAYLEDKLSFYNKHMEKYGQFTDFDGNANGSS 278
                  |.....|    .|..||..::. |.::|:..:..||               |.::....
 Frog   159 LLFISNGSQRVVSSECGSSSSSCSPEWNDSDFSGSQSDHLLS---------------DDSSEQRD 208

  Fly   279 LDCLNLIVQSINK---STTSPIQN 299
            ::.|:.||.||..   |.|.|.|:
 Frog   209 INSLSSIVDSITSGEVSITYPEQH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 21/76 (28%)
HLH 162..213 CDD:278439 39/50 (78%)
myogNP_001016725.1 BASIC 1..96 CDD:128794 34/131 (26%)
HLH 92..143 CDD:306515 39/50 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.