DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and MYOG

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_002470.2 Gene:MYOG / 4656 HGNCID:7612 Length:224 Species:Homo sapiens


Alignment Length:233 Identity:88/233 - (37%)
Similarity:109/233 - (46%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YSHANHNPVELD--KPLGMNMT--------PSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSR 143
            |...|:.||.|.  :|.|...|        |.|:       |:..|.:.||      |..     
Human    17 YDGENYLPVHLQGFEPPGYERTELTLSPEAPGPL-------EDKGLGTPEH------CPG----- 63

  Fly   144 PCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEY 208
            .||.||||.||:|||:||||:|||:||:|||:|||||||.|||.|..|||||||||||||:||:|
Human    64 QCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQY 128

  Fly   209 IESLEDLL----QESSTT--RDGDNLAPSLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQF 267
            ||.|:.||    ||....  |.|....|.:..: |.|...|.                ..::|..
Human   129 IERLQALLSSLNQEERDLRYRGGGGPQPGVPSE-CSSHSASC----------------SPEWGSA 176

  Fly   268 TDFDGN----------ANGSSLDCLNLIVQSINKSTTS 295
            .:|..|          .:..:|..|..||.||.....|
Human   177 LEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 30/86 (35%)
HLH 162..213 CDD:278439 39/50 (78%)
MYOGNP_002470.2 BASIC 1..86 CDD:128794 30/86 (35%)
bHLH_TS_MYOG_Myf4 81..139 CDD:381505 43/57 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.