DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and MYOD1

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_002469.2 Gene:MYOD1 / 4654 HGNCID:7611 Length:320 Species:Homo sapiens


Alignment Length:244 Identity:97/244 - (39%)
Similarity:117/244 - (47%) Gaps:70/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSN 191
            :|||.||   |....:..||.|||||||:|:...||||||||||||||.|||||||.|||.||||
Human    78 DEHVRAP---SGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSN 139

  Fly   192 PNQRLPKVEILRNAIEYIESLEDLLQESST------------------------TRDGDNLAPSL 232
            |||||||||||||||.|||.|:.||::...                        :.|.|..:|..
Human   140 PNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRS 204

  Fly   233 SGKSCQSDY---------LSSYAGAYLEDKLSFYNK--HMEKYGQFTDFDGNANGSSLDCLNLIV 286
            :......||         .:.|.|||       ||:  ...:.|:      :|..||||||:.||
Human   205 NCSDGMMDYSGPPSGARRRNCYEGAY-------YNEAPSEPRPGK------SAAVSSLDCLSSIV 256

  Fly   287 QSINKSTTSPI-----------------QNKATPSASDTQSPPSSGATA 318
            :.|  ||.||.                 |..|.||..::...|:....|
Human   257 ERI--STESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSPDA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 20/38 (53%)
HLH 162..213 CDD:278439 45/50 (90%)
MYOD1NP_002469.2 BASIC 19..114 CDD:128794 20/38 (53%)
bHLH_TS_MYOD1_Myf3 105..165 CDD:381506 48/59 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..219 5/44 (11%)
Myf5 191..259 CDD:403446 21/80 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..320 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159036
Domainoid 1 1.000 90 1.000 Domainoid score I7780
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4470
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 1 1.000 - - otm40940
orthoMCL 1 0.900 - - OOG6_110195
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.