DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and myf6

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001003982.1 Gene:myf6 / 404208 ZFINID:ZDB-GENE-040309-2 Length:239 Species:Danio rerio


Alignment Length:242 Identity:97/242 - (40%)
Similarity:119/242 - (49%) Gaps:64/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YSHANHNPVEL----------DKPLGMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSR 143
            |...:|..:::          |.||.....|.|      .:.....|.||||||| ....|....
Zfish    17 YLEGDHGTLDMPGVSPLYEGNDSPLSPGQDPVP------SETGCESSGEEHVLAP-PGLQAHCEG 74

  Fly   144 PCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEY 208
            .||.||||.||:||...|||||||:||||||:|:||||:.||::|..|||||||||||||:||.|
Zfish    75 QCLMWACKICKRKSAPTDRRKAATLRERRRLKKINEAFDALKKKTVPNPNQRLPKVEILRSAINY 139

  Fly   209 IESLEDLL-----QESSTTRD-------GDNLAPSLS--GKSCQS-----DYLSSY-----AGAY 249
            ||.|:|||     ||.|...|       .:::.||..  .|:|||     |:.||.     .||.
Zfish   140 IEKLQDLLHSLDEQEQSNDTDPYTYNLKENHVTPSEYHWKKTCQSWQENPDHSSSQMAGHREGAV 204

  Fly   250 LEDKLSFYNKHMEKYGQFTDFDGNANGSSLDCLNLIVQSINKSTTSP 296
            ||                     ::..|||..|:.||.||  ||..|
Zfish   205 LE---------------------SSESSSLRRLSSIVDSI--STEEP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 30/86 (35%)
HLH 162..213 CDD:278439 38/50 (76%)
myf6NP_001003982.1 Basic 2..92 CDD:279868 26/81 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..59 6/36 (17%)
HLH 93..144 CDD:278439 38/50 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..239 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595013
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.