DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and myf5

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_988932.1 Gene:myf5 / 394529 XenbaseID:XB-GENE-493550 Length:255 Species:Xenopus tropicalis


Alignment Length:278 Identity:109/278 - (39%)
Similarity:139/278 - (50%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SCNYSHANHNPVELDKPLGMNMTPSPIYTTDYDDENS----------SLSSEEHVLAPLVCSSAQ 140
            :|::|     |.|.........:|...||.||:...|          ....:|||.||:....|.
 Frog     6 TCHFS-----PSEFFYDSSCIPSPEEGYTEDYEHGMSLYGAHKKDLQESDEDEHVRAPIGHHQAG 65

  Fly   141 SSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNA 205
            :   ||.|||||||:||.|:||||||||||||||:|||:|||.|||.|::|||||||||||||||
 Frog    66 N---CLMWACKACKRKSSTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNA 127

  Fly   206 IEYIESLEDLLQE-------------------SSTTRDG--DNLAPSLSGKSCQSD--YLSSYAG 247
            |:|||||:|||||                   :|:..||  |..:|..||::...|  |.|....
 Frog   128 IKYIESLQDLLQEQVENYYSLPGQSCTEPGSPTSSCSDGMTDCSSPQWSGRNSSFDNVYCSDLQT 192

  Fly   248 AYLEDKLSFYNKHMEKYGQFTDFDGNANGSSLDCLNLIVQSINKS--TTSPIQNKATPSASDTQS 310
            ::...||:.                    ||||||:.||..|:.|  .:.||             
 Frog   193 SFSSTKLTL--------------------SSLDCLSSIVDRISSSEQCSLPI------------- 224

  Fly   311 PPSSGATAPTSLHVNFKR 328
             |.|.:.:|||...:|.|
 Frog   225 -PDSLSLSPTSSTDSFPR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 31/86 (36%)
HLH 162..213 CDD:278439 43/50 (86%)
myf5NP_988932.1 BASIC 1..88 CDD:128794 32/89 (36%)
bHLH_TS_Myf5 83..146 CDD:381507 50/62 (81%)
Myf5 143..214 CDD:371979 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7571
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4333
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 1 1.000 - - otm48135
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.