DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nau and myog

DIOPT Version :9

Sequence 1:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_571081.1 Gene:myog / 30200 ZFINID:ZDB-GENE-980526-265 Length:256 Species:Danio rerio


Alignment Length:293 Identity:102/293 - (34%)
Similarity:134/293 - (45%) Gaps:84/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QQNPIAHPGQNPHQTLQNFFSRFNAVGDASAGNGG---AASISANGSGSSCNYSHANHNPVEL-D 100
            :.||.....|..::...|||.        |..|||   |.....|.....|.........|.| |
Zfish     5 ETNPYFFNDQRFYEGADNFFQ--------SRINGGFEQAGYQDRNSMMGLCGDGRMLTTTVGLED 61

  Fly   101 KP-----LGMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTV 160
            ||     ||::|:|.              ..::|      |..     .||.||||.||:||||:
Zfish    62 KPSPSSSLGLSMSPH--------------QEQQH------CPG-----QCLPWACKVCKRKSVTM 101

  Fly   161 DRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLLQE-SSTTRD 224
            |||||||:||:|||:|||||||.|||.|..|||||||||||||:||:|||.|:.|:.. :....:
Zfish   102 DRRKAATLREKRRLKKVNEAFEALKRSTLMNPNQRLPKVEILRSAIQYIERLQALVSSLNQQEHE 166

  Fly   225 GDNL-------APSL---------SGKSC--------QSDY-LSSYAGAYLEDKLSFYNKHMEKY 264
            ..||       ||..         ||.:|        .||: :.:|:.|: ||.|:         
Zfish   167 QGNLHYRATAAAPHTGVSSSSDQGSGSTCCSSPEWSSASDHCVPAYSSAH-EDLLN--------- 221

  Fly   265 GQFTDFDGNANGSSLDCLNLIVQSINKSTTSPI 297
                  |.::..|:|..|..||.||..:..:|:
Zfish   222 ------DDSSEQSNLRSLTSIVDSITGTEATPV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nauNP_476650.1 Basic 89..166 CDD:299793 27/82 (33%)
HLH 162..213 CDD:278439 40/50 (80%)
myogNP_571081.1 BASIC 1..107 CDD:128794 40/134 (30%)
HLH 103..154 CDD:278439 40/50 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.