DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SEC14L5

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:320 Identity:61/320 - (19%)
Similarity:119/320 - (37%) Gaps:69/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKLAALAK--SECNEEQAQRA---------EIIATIKTWITKSPHLKAPTDEQLILAFLRRC 60
            ||.|.|.|::.  .:.:.:..:|.         ..:..::.|:.::...|.|.||. ||.|||..
Human   211 TLGPALEAVSMDGDKLDADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKDEH-ILRFLRAH 274

  Fly    61 RFSQEETKRRFDNYYSLRSVFPEVLGSRQVD--------EALLTQLQRG---IHVIPMRPVSPEG 114
            .|..::.:.......|.|.       ..|||        .|||.:...|   ...|..||     
Human   275 DFHLDKAREMLRQSLSWRK-------QHQVDLLLQTWQPPALLEEFYAGGWHYQDIDGRP----- 327

  Fly   115 PRVIISQFRNIDPK---KSNPREAFKLIFIMLELLAL------ECDNAA------ISGLIWVVDA 164
              :.|.:...:|.|   |:...||     ::..:|::      .|:.:.      ||....::|.
Human   328 --LYILRLGQMDTKGLMKAVGEEA-----LLRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDL 385

  Fly   165 RDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVH 229
            ..:.|..:.:.....|.:...:|:...|.....:.::...:....::..::.|:......||:::
Human   386 EGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIY 450

  Fly   230 KKSE-----DLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKD-YLAKDAQYGTNE 283
            ..|.     .|..:|.|:|:....||      |:|.:..:..|..|. |:.::.|..|::
Human   451 SGSNYQGPGGLVDYLDREVIPDFLGG------ESVCNVPEGGLVPKSLYMTEEEQEHTDQ 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/178 (16%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 2/2 (100%)
CRAL_TRIO_N 243..288 CDD:215024 11/45 (24%)
SEC14 306..479 CDD:214706 33/190 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.