DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and PDR17

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_014135.1 Gene:PDR17 / 855457 SGDID:S000005208 Length:350 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:52/226 - (23%)
Similarity:88/226 - (38%) Gaps:62/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVI-PMRPVS 111
            |.:|:||.|        :..||..  ||        :...||..|:...|:|..:::: ....|:
Yeast   146 TGKQVILGF--------DNAKRPL--YY--------MKNGRQNTESSFRQVQELVYMMETATTVA 192

  Fly   112 PEGPR--VIISQFRN-----IDPKKSNPREAFKLIFIML-----ELLALECDNAAISGLIWVVDA 164
            |:|..  .::..|::     |...|:.|....::...::     |.|| :|....|....|..  
Yeast   193 PQGVEKITVLVDFKSYKEPGIITDKAPPISIARMCLNVMQDHYPERLA-KCVLINIPWFAWAF-- 254

  Fly   165 RDVTMEQMMQYDPFL--LKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFV 227
                  ..|.| |||  ..||.|:.|:  |.   |.|:...:.:  .::|.:..|     .:|..
Yeast   255 ------LKMMY-PFLDPATKAKAIFDE--PF---ENHIEPSQLD--ALYNGLLDF-----KYKHE 300

  Fly   228 VH-----KKSEDLYQHLPRDVMTIEYGGTNG 253
            |:     ||.:||  .|.|....:::||..|
Yeast   301 VYWPDMVKKVDDL--RLKRFDRFLKFGGIVG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 38/175 (22%)
PDR17NP_014135.1 CRAL_TRIO_N 49..115 CDD:397711
CRAL_TRIO 146..291 CDD:395525 39/179 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.