DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SEC14

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:306 Identity:52/306 - (16%)
Similarity:110/306 - (35%) Gaps:71/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLR 78
            ||..:..|.:.||. :.:|.::..:..:..::. .|:..:|.|||..:|..:..|..|:|....|
Yeast    21 ALPGTPGNLDSAQE-KALAELRKLLEDAGFIER-LDDSTLLRFLRARKFDVQLAKEMFENCEKWR 83

  Fly    79 SVF--PEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFI 141
            ..:  ..:|.....||               :|:..:    ...|:.:...|...|....:|..:
Yeast    84 KDYGTDTILQDFHYDE---------------KPLIAK----FYPQYYHKTDKDGRPVYFEELGAV 129

  Fly   142 ML-ELLALECDNAAISGLIW--------------------------VVDARDVTME---QMMQYD 176
            .| |:..:..:...:..|:|                          ::|.:.:::.   .:|.| 
Yeast   130 NLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYSVMSY- 193

  Fly   177 PFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKS--EDLYQHL 239
               :::|..:.....|.|..:.::||......|.|.....||......|..:...|  ::|.:.:
Yeast   194 ---VREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQI 255

  Fly   240 PRDVMTIEYGGTN-------GYQAEAVDHWRQKLLDSKDYLAKDAQ 278
            |.:.:.:::||.:       |.....:..||    |.| |:..:.:
Yeast   256 PAENLPVKFGGKSEVDESKGGLYLSDIGPWR----DPK-YIGPEGE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 26/187 (14%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 9/46 (20%)
SEC14 99..269 CDD:214706 28/192 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.