DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SFH5

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:19/78 - (24%)
Similarity:28/78 - (35%) Gaps:24/78 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 IFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLA 274
            :::.:.||:......||||......|.|:| :|.....|||.                |.|:.|.
Yeast   221 VYDLIKKFVDETTRKKFVVLTDGSKLGQYL-KDCPYEGYGGK----------------DKKNNLT 268

  Fly   275 KD-------AQYG 280
            |.       .:||
Yeast   269 KQNVTNVHPTEYG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 12/40 (30%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.