DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT1G75370

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001154472.1 Gene:AT1G75370 / 843873 AraportID:AT1G75370 Length:668 Species:Arabidopsis thaliana


Alignment Length:221 Identity:53/221 - (23%)
Similarity:80/221 - (36%) Gaps:62/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SPHLKAPT--DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFP-----EVLGSRQVDEALLTQL 98
            |.:|..||  |..::|.||:..:|...:||..:.|....|..|.     |.....:.|| :|...
plant   100 SENLLPPTLDDYHIMLRFLKARKFDIGKTKLMWSNMIKWRKDFGTDTIFEDFEFEEFDE-VLKYY 163

  Fly    99 QRGIHVIPMRPVSPEGPRVIISQFRNIDPKK------------SNPREAFKLIFIMLELLALECD 151
            ..|.|     .|..||..|.|.:...:||.|            .:.||..|.:.|.|.    .|.
plant   164 PHGYH-----GVDKEGRPVYIERLGLVDPAKLMQVTTVERFIRYHVREFEKTVNIKLP----ACC 219

  Fly   152 NAA---ISGLIWVVD------------ARDVTMEQMMQYD----PFLLKKAF------------A 185
            .||   |.....::|            |||:.: |:.:.|    |..|.:.|            |
plant   220 IAAKRHIDSSTTILDVQGVGFKNFSKPARDLII-QLQKIDNDNYPETLHRMFIINGGSGFKLVWA 283

  Fly   186 LVDQCI-PLRFVEIHMINMRKEGQTI 210
            .|.|.: |....:||:|..:.:.:.:
plant   284 TVKQFLDPKTVTKIHVIGNKYQNKLL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 36/160 (23%)
AT1G75370NP_001154472.1 CRAL_TRIO_N 89..135 CDD:215024 11/34 (32%)
SEC14 159..324 CDD:238099 36/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.