DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT1G55690

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001323358.1 Gene:AT1G55690 / 842018 AraportID:AT1G55690 Length:625 Species:Arabidopsis thaliana


Alignment Length:177 Identity:36/177 - (20%)
Similarity:60/177 - (33%) Gaps:58/177 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRTLDPKLAALAKSECNEEQAQRAEIIATIKTWI---TKSPH---------------------LK 45
            :.|||......:..|.:|::.:|::|....|..|   ||..|                     ::
plant     7 ISTLDEFRERRSDFEISEDERRRSKIGNLKKKAINASTKFTHSLKKRGKRKIDYRVPAVSIEDVR 71

  Fly    46 APTDEQLILAFLRRCRFSQEETKRRFDNYYSL--------------RSVFPEVLGSRQ---VD-- 91
            ...:|.::|.| ||....::....|.|.|::|              ..::.|:|..|:   .|  
plant    72 DEKEESVVLEF-RRKLLERDLLPPRHDEYHTLLRFLKARDLNIEKTTQLWEEMLRWRKEYGTDTI 135

  Fly    92 ---------EALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKK 129
                     |.:|....:|.|     .|..||..|.|.:.....|.|
plant   136 LEDFDFEELEEVLQYYPQGYH-----GVDKEGRPVYIERLGKAHPSK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 10/35 (29%)
AT1G55690NP_001323358.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.