DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT1G30690

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001031119.1 Gene:AT1G30690 / 839949 AraportID:AT1G30690 Length:540 Species:Arabidopsis thaliana


Alignment Length:264 Identity:55/264 - (20%)
Similarity:103/264 - (39%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSECNEEQAQRAEIIATIKTW-ITKSPHLKAPTDEQLILAFLRRCRFSQEET--------KRRFD 72
            |:|..|.:.:...:...|:.| :...|...|.:.:.::|.|||...|...|.        |.|..
plant   186 KAETIEVEDEDESVDKDIELWGVPLLPSKGAESTDVILLKFLRARDFKVNEAFEMLKKTLKWRKQ 250

  Fly    73 NYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAF- 136
            |  .:.|:..|..|......|.:..:.|..|.:.....|.|       .::.|..:|:  ||.| 
plant   251 N--KIDSILGEEFGEDLATAAYMNGVDRESHPVCYNVHSEE-------LYQTIGSEKN--REKFL 304

  Fly   137 KLIFIMLE--LLALECDNAAISGLIWVVDARD----------VTMEQMMQ-----YDPFLLKKAF 184
            :..|.::|  :..|......::.|:.:.|.::          |.::::::     |..|:.:..|
plant   305 RWRFQLMEKGIQKLNLKPGGVTSLLQIHDLKNAPGVSRTEIWVGIKKVIETLQDNYPEFVSRNIF 369

  Fly   185 ALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVV---HKKSEDLYQHLPRDVMTI 246
            ..|    |..|..:..:            ::.||..:...||||   .|..|.|.:::|.|.:.:
plant   370 INV----PFWFYAMRAV------------LSPFLTQRTKSKFVVARPAKVRETLLKYIPADELPV 418

  Fly   247 EYGG 250
            :|||
plant   419 QYGG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 35/177 (20%)
AT1G30690NP_001031119.1 CRAL_TRIO_N <219..244 CDD:215024 6/24 (25%)
SEC14 273..422 CDD:214706 33/173 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.