DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT1G01630

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_171669.1 Gene:AT1G01630 / 839231 AraportID:AT1G01630 Length:255 Species:Arabidopsis thaliana


Alignment Length:272 Identity:61/272 - (22%)
Similarity:102/272 - (37%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTLRTLDPKLAALAKS-ECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQ 64
            |.|.....:|..||..|: ...|::.:|:::.........:.|..| ..|:.:|..|||......
plant     1 MENKETKQEPAAAAEQKTVPLIEDEIERSKVGIMRALCDRQDPETK-EVDDLMIRRFLRARDLDI 64

  Fly    65 EETKRRFDNYYS-LRSVFPEVLGSRQVDEALLT-------QLQRGIHVIPMRPVSPEGPRVIISQ 121
            |:....|.||.: .||:.|:    ..:.||.:.       ...:| |....||::     |.|..
plant    65 EKASTMFLNYLTWKRSMLPK----GHIPEAEIANDLSHNKMCMQG-HDKMGRPIA-----VAIGN 119

  Fly   122 FRNIDPKKSNPREAFKLIFIMLELLALECDN-----AAISGLI-WVVDARDVTMEQMMQYDPFLL 180
            ..|  |.|.||.|..:.:...||.:......     .||..|. |.....|:.        .:| 
plant   120 RHN--PSKGNPDEFKRFVVYTLEKICARMPRGQEKFVAIGDLQGWGYSNCDIR--------GYL- 173

  Fly   181 KKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLP--SKLPFKFVVHKK-----SEDLYQH 238
             .|.:.:..|.|.|..::::::......|.:..:..|:.  :|....||.:||     .||:.:.
plant   174 -AALSTLQDCYPERLGKLYIVHAPYIFMTAWKVIYPFIDANTKKKIVFVENKKLTPTLLEDIDES 237

  Fly   239 LPRDVMTIEYGG 250
            ...|:    |||
plant   238 QLPDI----YGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 37/176 (21%)
AT1G01630NP_171669.1 CRAL_TRIO_N 29..74 CDD:215024 9/45 (20%)
SEC14 103..246 CDD:238099 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.