DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT5G56160

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001331164.1 Gene:AT5G56160 / 835715 AraportID:AT5G56160 Length:577 Species:Arabidopsis thaliana


Alignment Length:106 Identity:20/106 - (18%)
Similarity:39/106 - (36%) Gaps:23/106 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFP-----EVLGSRQVDEALLTQLQRGIHVIPMR 108
            |..::|.||:...|..|:|...::.....|..|.     :....:::|| :.....:|.|     
plant    91 DYHMLLRFLKTMEFKIEKTVTAWEEMLKWRKEFGTDRIIQDFNFKELDE-VTRHYPQGYH----- 149

  Fly   109 PVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALE 149
            .|..:|..:.|.:.....|.|            ::|:..:|
plant   150 GVDKDGRPIYIERLGKAHPGK------------LMEVTTIE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 9/55 (16%)
AT5G56160NP_001331164.1 CRAL_TRIO_N 69..116 CDD:215024 7/24 (29%)
SEC14 136..308 CDD:214706 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.