DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT5G47510

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001331127.1 Gene:AT5G47510 / 834801 AraportID:AT5G47510 Length:377 Species:Arabidopsis thaliana


Alignment Length:231 Identity:48/231 - (20%)
Similarity:82/231 - (35%) Gaps:56/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEQAQRAEIIATIKTWITKSPHLKAPT---DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPE 83
            |:.....|::...:..:....||  |.   |...:..||:...|..|::|..|.||...|..:  
plant    20 EQSPNNEEMVEAFRNLLLLHGHL--PDKHGDHNTLRRFLKMRDFDLEKSKEAFLNYMKWRVDY-- 80

  Fly    84 VLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLAL 148
                 :||  |::|..:......::...|.|       |..:| |...|        |.:|.|.:
plant    81 -----KVD--LISQKFKFEEYGEVKKHYPHG-------FHKVD-KTGRP--------IYIERLGM 122

  Fly   149 ECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFAL------------VDQCIPLRFVE-IHM 200
            ...||.:         :..|:|:.:.|.....:|..:|            |.....:..|. :.|
plant   123 TDLNAFL---------KATTIERYVNYHIKEQEKTMSLRYPACSIASDKHVSSTTTILDVSGVGM 178

  Fly   201 INMRKEGQTIFNFVTK----FLPSKLPFKFVVHKKS 232
            .|..|..:::|..:.|    :.|..|...|||:..|
plant   179 SNFSKPARSLFMEIQKIDSNYYPETLHRLFVVNASS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/155 (19%)
AT5G47510NP_001331127.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.