DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SEC14

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_195629.2 Gene:SEC14 / 830073 AraportID:AT4G39180 Length:554 Species:Arabidopsis thaliana


Alignment Length:236 Identity:47/236 - (19%)
Similarity:87/236 - (36%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ECNEEQAQRAEII--ATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVF 81
            |.:.|:.|..:..  |.|...:..|.|    .|..::|.|||..:|..|:.|:.:.:..:.|..:
plant    65 EIDTEELQAVDAFRQALILDELLPSKH----DDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEY 125

  Fly    82 -----PEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLI-- 139
                 .|....::::| ::....:|.|     .|..||..:.|.:...:|        |.||:  
plant   126 GADTIMEDFDFKEIEE-VVKYYPQGYH-----GVDKEGRPIYIERLGQVD--------ATKLMKV 176

  Fly   140 -----FIMLELLALE---------CDNAA---ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALV 187
                 ::...:...|         |..||   |.....::|.:.|.:....:....||:....:.
plant   177 TTIDRYVKYHVKEFEKTFNVKFPACSIAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKID 241

  Fly   188 DQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVV 228
            :...|.....:.:||.....:.::|.|..||..|...|..|
plant   242 NDNYPETLNRMFIINAGCGFRLLWNTVKSFLDPKTTAKIHV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/153 (19%)
SEC14NP_195629.2 CRAL_TRIO_N 72..115 CDD:215024 13/46 (28%)
SEC14 138..308 CDD:214706 30/159 (19%)
Prefoldin 491..>529 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.