DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT4G39170

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_568054.1 Gene:AT4G39170 / 830072 AraportID:AT4G39170 Length:614 Species:Arabidopsis thaliana


Alignment Length:211 Identity:47/211 - (22%)
Similarity:80/211 - (37%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGS---------RQVDEALLTQ 97
            ||  ...|..::|.||:..:|..|:.|..:.:....|..|    |:         .::|| :|..
plant   100 PH--KHDDYHMMLRFLKARKFDIEKAKHMWADMIQWRKEF----GTDTIIQDFQFEEIDE-VLKY 157

  Fly    98 LQRGIHVIPMRPVSPEGPRVIISQFRNIDPKK------------SNPREAFKLIFIMLELLALEC 150
            ...|.|     .|..||..|.|.:...:||.|            .:.:| |:..| ||:..|  |
plant   158 YPHGYH-----SVDKEGRPVYIERLGKVDPNKLMQVTTLDRYIRYHVKE-FERSF-MLKFPA--C 213

  Fly   151 DNAA---ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFN 212
            ..||   |.....::|.:.|.::...:....|:.:...:.....|....::.:||.....:.:::
plant   214 TIAAKKYIDSSTTILDVQGVGLKNFTKSARELITRLQKIDGDNYPETLHQMFIINAGPGFRLLWS 278

  Fly   213 FVTKFLPSKLPFKFVV 228
            .|..||..|...|..|
plant   279 TVKSFLDPKTTSKIHV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/149 (22%)
AT4G39170NP_568054.1 CRAL_TRIO_N 84..130 CDD:215024 9/31 (29%)
SEC14 150..318 CDD:214706 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.