DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and COW1

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001328041.1 Gene:COW1 / 829610 AraportID:AT4G34580 Length:554 Species:Arabidopsis thaliana


Alignment Length:224 Identity:46/224 - (20%)
Similarity:84/224 - (37%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFP-----EVLGSRQVDEALLTQLQRGIHVIPMR 108
            |..::|.|||..:|..|:.|:.:.:....|..|.     |.....::|| ::....:|.|     
plant    85 DLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDFDFEEIDE-VMKHYPQGYH----- 143

  Fly   109 PVSPEGPRVIISQFRNIDPKK---------------SNPREAFKLIFIMLELLALECDNAAISGL 158
            .|..||..|.|.:...||..|               ....:.||:.|....:.|    |..|...
plant   144 GVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFKVKFPSCSVAA----NKHIDQS 204

  Fly   159 IWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLP 223
            ..::|.:.|.::...:....||::...:.::..|.....:.:||.....:.:::.|..||..|..
plant   205 TTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTT 269

  Fly   224 FKFVV--HKKSEDLYQHLPRDVMTIEYGG 250
            .|..|  :|....|.:.:....:...:||
plant   270 AKIHVLGNKYHSKLLEVIDASELPEFFGG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/173 (19%)
COW1NP_001328041.1 CRAL_TRIO_N 64..107 CDD:215024 8/21 (38%)
SEC14 133..298 CDD:214706 32/174 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.