DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT4G09160

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_192655.2 Gene:AT4G09160 / 826497 AraportID:AT4G09160 Length:668 Species:Arabidopsis thaliana


Alignment Length:271 Identity:60/271 - (22%)
Similarity:108/271 - (39%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLAALAKSECNEEQAQRAEIIA---TIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFD 72
            |::.|:::|.|..|..|..:..   :.||.|...|.||....:.::|.|||...|..:|.....:
plant   297 KISDLSETELNALQELRHLLQVSQDSSKTSIWGVPLLKDDRTDVVLLKFLRARDFKPQEAYSMLN 361

  Fly    73 NYYSLRSVF--PEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRV---IISQFRNIDP----- 127
            .....|..|  .|:|     ||.|...|.:   |:.|:....|...|   :..:|:|.|.     
plant   362 KTLQWRIDFNIEELL-----DENLGDDLDK---VVFMQGQDKENHPVCYNVYGEFQNKDLYQKTF 418

  Fly   128 KKSNPREAF---KLIFIMLELLALECDNAAISGLIWVVDARD----------VTMEQMM-----Q 174
            .....||.|   ::.|:...:..|:.....:|.:..|.|.::          :..:|.:     .
plant   419 SDEEKRERFLRWRIQFLEKSIRNLDFVAGGVSTICQVNDLKNSPGPGKTELRLATKQALHLLQDN 483

  Fly   175 YDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHL 239
            |..|:.|:.|..|    |..::..:.|        |..|:::...|||.|. ...:.:|.|.:::
plant   484 YPEFVSKQIFINV----PWWYLAFYRI--------ISPFMSQRSKSKLVFA-GPSRSAETLLKYI 535

  Fly   240 PRDVMTIEYGG 250
            ..:.:.::|||
plant   536 SPEHVPVQYGG 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 35/182 (19%)
AT4G09160NP_192655.2 CRAL_TRIO_N 308..360 CDD:281722 14/51 (27%)
SEC14 383..547 CDD:238099 35/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.