DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT4G08690

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001031598.1 Gene:AT4G08690 / 826436 AraportID:AT4G08690 Length:301 Species:Arabidopsis thaliana


Alignment Length:291 Identity:56/291 - (19%)
Similarity:100/291 - (34%) Gaps:84/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQ-RGIHV--------------IPMRP----- 109
            ||.:.:.:....|....||.|.|...|:|:|..|: |..||              :..:|     
plant    17 EEEQAKIEEVRKLLGPLPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQYKPEEICW 81

  Fly   110 -----------------VSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECDNAAIS- 156
                             |...|..|:|.: .:::..||...:...|::.|        :||..: 
plant    82 EEVAGEAETGKIYRSSCVDKLGRPVLIMR-PSVENSKSVKGQIRYLVYCM--------ENAVQNL 137

  Fly   157 -----GLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTK 216
                 .::|::|....::..:...   ..|:...::.:..|.|.....:.|..|..:..:.....
plant   138 PPGEEQMVWMIDFHGYSLANVSLR---TTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWKVARP 199

  Fly   217 FLPSKL--PFKFVVHKKSED------LYQHLPRDVMTIEYGGT--NGYQAEAVDHWRQKLLDSKD 271
            ||..|.  ..|||.   |:|      :.::...:.|.:.:||.  :|:..|  .|..:...|.|.
plant   200 FLEPKTRNKVKFVY---SDDPNTKVIMEENFDMEKMELAFGGNDDSGFNIE--KHSERMKEDDKK 259

  Fly   272 YLAKDAQYGTNEKLRVGLASAWANGELDGMS 302
            .||.          ..|:.||    .||.:|
plant   260 RLAS----------LEGIVSA----SLDSLS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/206 (16%)
AT4G08690NP_001031598.1 CRAL_TRIO_N 20..67 CDD:215024 12/46 (26%)
SEC14 87..241 CDD:214706 28/168 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.