DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT3G24840

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001327840.1 Gene:AT3G24840 / 822082 AraportID:AT3G24840 Length:580 Species:Arabidopsis thaliana


Alignment Length:310 Identity:59/310 - (19%)
Similarity:96/310 - (30%) Gaps:109/310 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DEQLILAFLRRCRFSQEETKRR---------------------FDNYYSLRSVFPEVLGSRQVDE 92
            |...:|.||:..||..|:|.:.                     :|.|..::..:|          
plant   100 DYHTMLRFLKARRFDLEKTVQMWEEMLKWRKENGVDTIIQDFVYDEYEEVQQYYP---------- 154

  Fly    93 ALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALE-------- 149
                   .|.|     .|..||..|.|.:...|||.|            ::::..||        
plant   155 -------HGYH-----GVDREGRPVYIERLGKIDPGK------------LMKVTTLERFLRYHVQ 195

  Fly   150 ------------CDNAA---ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIH 199
                        |..||   |:....::|...|:.....:....|:.:...:.....|....:::
plant   196 GFEKTFSEKFPACSIAAKRHINSSTTIIDVHGVSWMSFRKLAQDLVMRMQKIDGDNYPETLNQMY 260

  Fly   200 MINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHL-----PRDVMTIEYGGTN------- 252
            :||.....:.::|.|..||..|...|  :|........||     |.::.  |:.|.|       
plant   261 IINAGNGFKLVWNTVKGFLDPKTTSK--IHVLGNKYRSHLLEIIDPSELP--EFLGGNCKCAHEG 321

  Fly   253 GYQAEAVDHWR----QKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGEL 298
            |........|.    .||:.|:|.:.|..:.|..|           |||:
plant   322 GCMRFNKGPWNDPEIMKLVRSRDAMYKPKEMGLLE-----------NGEV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 34/183 (19%)
AT3G24840NP_001327840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.