DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and SFH3

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001031389.1 Gene:SFH3 / 816693 AraportID:AT2G21540 Length:548 Species:Arabidopsis thaliana


Alignment Length:273 Identity:57/273 - (20%)
Similarity:98/273 - (35%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVF-- 81
            :..|.||..|...|.|...:..|.|    .|..::|.|||..:|..|:.|:.:.:....|..|  
plant    66 DLEELQAVDAFRQALILDELLPSKH----DDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGV 126

  Fly    82 ---PEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPK------------KSN 131
               .|....:::|| :|....:|.|     .|..:|..|.|.:...:|..            |.:
plant   127 DTIMEDFDFKEIDE-VLKYYPQGYH-----GVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYH 185

  Fly   132 PREAFKLIFIMLELLALECDNAA---ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPL 193
            .||..|...|.|.    .|..||   |.....::|.:.|.::...:....||::...:.....|.
plant   186 VREFEKTFNIKLP----ACSIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPE 246

  Fly   194 RFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEA 258
            ....:.:||.....:.:::.|..||..|...|  :|...                   |.||::.
plant   247 TLNRMFIINAGSGFRLLWSTVKSFLDPKTTAK--IHVLG-------------------NKYQSKL 290

  Fly   259 VDHWRQKLLDSKD 271
            ::     ::||.:
plant   291 LE-----IIDSNE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 31/170 (18%)
SFH3NP_001031389.1 CRAL_TRIO_N 71..117 CDD:215024 15/49 (31%)
SEC14 137..307 CDD:214706 38/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.