DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT2G18180

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_179410.1 Gene:AT2G18180 / 816331 AraportID:AT2G18180 Length:558 Species:Arabidopsis thaliana


Alignment Length:233 Identity:44/233 - (18%)
Similarity:87/233 - (37%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NEEQAQRAEIIATIKTWITKSPHLKAPTDE-QLILAFLRRCRFSQEETKRRFDNYYSLRSVF--- 81
            :|..|:..:::...:..:.....|....|: .::|.||:..:|..|:|.:.:.:....|..|   
plant    49 DEHDAEELKVVDAFRQVLILDELLPDKHDDYHMMLRFLKARKFDLEKTNQMWSDMLRWRKEFGAD 113

  Fly    82 --PEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLI----- 139
              .|....:::|| :|....:|.|     .|..||..|.|.:...:|        :.||:     
plant   114 TVMEDFEFKEIDE-VLKYYPQGHH-----GVDKEGRPVYIERLGQVD--------STKLMQVTTM 164

  Fly   140 --FIMLELLALE---------CDNAA---ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQC 190
              ::...::..|         |..||   |.....::|.:.|.::...:....|:.:...:....
plant   165 DRYVNYHVMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDN 229

  Fly   191 IPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVV 228
            .|.....:.:||.....:.::|.|..||..|...|..|
plant   230 YPETLNRMFIINAGSGFRMLWNTVKSFLDPKTTAKIHV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/153 (19%)
AT2G18180NP_179410.1 CRAL_TRIO_N 57..100 CDD:215024 8/42 (19%)
SEC14 123..293 CDD:214706 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.