DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AT2G16380

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001323459.1 Gene:AT2G16380 / 816135 AraportID:AT2G16380 Length:547 Species:Arabidopsis thaliana


Alignment Length:220 Identity:45/220 - (20%)
Similarity:86/220 - (39%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFP-----EVLGSRQVDEALLTQLQRGIHVIPMR 108
            |..::|.|||..:|.:|:.|:.:.:....|..|.     |.....::|: :|....:|.|     
plant    85 DLHMMLRFLRARKFDKEKAKQMWSDMLQWRMDFGVDTIIEDFEFEEIDQ-VLKHYPQGYH----- 143

  Fly   109 PVSPEGPRVIISQFRNIDPKK---SNPREAFKLIFI-----MLELLALECDNAA---ISGLIWVV 162
            .|..||..|.|.:...||..|   :...:.::...:     |.::....|..||   |.....:.
plant   144 GVDKEGRPVYIERLGQIDANKLLQATTMDRYEKYHVKEFEKMFKIKFPSCSAAAKKHIDQSTTIF 208

  Fly   163 DARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFV 227
            |.:.|.::...:....||::...:.:...|.....:.:||.....:.::..:.|||..|...|..
plant   209 DVQGVGLKNFNKSARELLQRLLKIDNDNYPETLNRMFIINAGPGFRLLWAPIKKFLDPKTTSKIH 273

  Fly   228 V--HKKSEDLYQHLPRDVMTIEYGG 250
            |  :|....|.:.:....:...:||
plant   274 VLGNKYQPKLLEAIDASELPYFFGG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/169 (20%)
AT2G16380NP_001323459.1 CRAL_TRIO_N 65..107 CDD:215024 8/21 (38%)
SEC14 134..300 CDD:214706 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.